PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00082.1_g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 515aa    MW: 57854.8 Da    PI: 6.5941
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00082.1_g00023.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox222.8e-073323652154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++e++ +L +++gL+ +q+ +WF N+R +
  Rsa1.0_00082.1_g00023.1 332 KWPYPTEEDKVRLVQETGLQLKQINNWFINQRKR 365
                              469*****************************87 PP

2ELK28.53.5e-10286307122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELKh+L+++Y+++++++++E++
  Rsa1.0_00082.1_g00023.1 286 ELKHELKQGYKEKIVDIREEIL 307
                              9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-19120164IPR005540KNOX1
PfamPF037901.4E-17123163IPR005540KNOX1
SMARTSM012569.3E-28176232IPR005541KNOX2
PfamPF037916.8E-20182231IPR005541KNOX2
SMARTSM011886.1E-4286307IPR005539ELK domain
PfamPF037891.2E-6286307IPR005539ELK domain
PROSITE profilePS512139.969286306IPR005539ELK domain
PROSITE profilePS5007111.645306369IPR001356Homeobox domain
SMARTSM003893.3E-11308373IPR001356Homeobox domain
SuperFamilySSF466891.07E-15308372IPR009057Homeodomain-like
CDDcd000863.72E-11309370No hitNo description
Gene3DG3DSA:1.10.10.606.4E-25313370IPR009057Homeodomain-like
PfamPF059202.8E-17326365IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MAFHTNHFNH FIDQQHQPPP PHPQQQEHHF HESAPPNWLL RSDNNFLNLH TAASAAAASS  60
DSPSSAAANQ WLSRSSSFLQ RGGGANNNNV GSGDVIEDVT TGGEEAVIGE RKEAERWQNA  120
RHKAEILSHP LYEQLLSAHV ACLRIATPVD QLPRIDAQLA QSQNVVAKYS TVDAAAQGLI  180
SGDEKELDHF MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WEIEQSLQSL TGVSPGEGTG  240
ATMSEDEDEQ VESDVHTYEG SLDGLGFGPL VPTESERSLM ERVRQELKHE LKQGYKEKIV  300
DIREEILRKR RAGKLPGDTT SVLKAWWQSH SKWPYPTEED KVRLVQETGL QLKQINNWFI  360
NQRKRNWHSN PSSSTIPKNK RRSFPYECLD LWSFPDILVN LARVLFREEF RSWRAFNGDN  420
SSLSGFALRY RRLCLRGVEA SSTLLRRLGF REGGSFYSSI VAGSDTEGVL RLSSCRWMSE  480
ALRWKMDPVG SGEVAEVCGG RLGGAALSLG FFLWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12309373872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533380.0AK353338.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-40-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125259.10.0PREDICTED: homeobox protein knotted-1-like 4 isoform X1
SwissprotP480010.0KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLA0A078D9I60.0A0A078D9I6_BRANA; BnaA02g00810D protein
STRINGBra028554.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.10.0KNOTTED1-like homeobox gene 4